Protein Info for Dshi_1768 in Dinoroseobacter shibae DFL-12

Annotation: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 12 to 209 (198 residues), 225.2 bits, E=2.6e-71
• PF01081: Aldolase
  • amino acids 12 to 203 (192 residues), 216.9 bits, E=9.5e-69

Best Hits

Swiss-Prot: 52% identical to ALKH_ECOLI: KHG/KDPG aldolase (eda) from Escherichia coli (strain K12)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to dsh:Dshi_1768)

MetaCyc: 52% identical to 2-dehydro-3-deoxy-phosphogluconate aldolase (Pseudoalteromonas atlantica T6c)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• D-galactonate degradation (3/3 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• D-fructuronate degradation (2/4 steps found)
• D-glucosaminate degradation (1/3 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• D-galacturonate degradation I (2/5 steps found)
• L-glucose degradation (3/7 steps found)
• superpathway of β-D-glucuronosides degradation (3/7 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (1/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (2/7 steps found)
• superpathway of hexuronide and hexuronate degradation (4/10 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (9/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

See A8LMG5 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Dshi_1768 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTPSEASAQAREICGLAPVIPVLVIHDLAHARPLAEALVAGGLPALEVTLRTPVALDAIA
EMAQVEGGVVGAGTLLTPEDVAAAKAAGALFGVSPGATSRLLDAAEAADLPMLPGAATST
EVMALLERGYTVQKFFPAEANGGAPALKSIGAPLPQVAFCPTGGVSLANAPTYLGLGNTL
CVGGSWVAPQAMMEAGDWAGITELAAEAAALPR