Protein Info for Dshi_1681 in Dinoroseobacter shibae DFL-12

Annotation: thioesterase superfamily protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF20791: Acyl-ACP_TE_C" amino acids 34 to 69 (36 residues), 21.1 bits, see alignment 4.3e-08 PF13279: 4HBT_2" amino acids 35 to 150 (116 residues), 50.8 bits, see alignment E=3.5e-17 PF03061: 4HBT" amino acids 44 to 120 (77 residues), 35.3 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to dsh:Dshi_1681)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLP5 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dshi_1681 thioesterase superfamily protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTDPAKPTPLTPLLADDLRAAGVPEPWNYGMADRVRFHEIDALNHVNNAVCFSWFENLRV
HYLRDYGIYRYTPEDPMLVMRAVGASYNAPLFLGQDYILTARTRSFGRTSFVMDYGAFCD
GAFAIEGHAVIVLVEQDGRTGYPLTDEMRAIMASRDGATLRQA