Protein Info for Dshi_1677 in Dinoroseobacter shibae DFL-12
Annotation: Methionine synthase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 100% identity to dsh:Dshi_1677)Predicted SEED Role
"Pterin-binding enzyme domain protein"
MetaCyc Pathways
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- aspartate superpathway (21/25 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-methionine biosynthesis III (4/4 steps found)
- L-methionine salvage from L-homocysteine (3/3 steps found)
- folate transformations III (E. coli) (7/9 steps found)
- L-methionine biosynthesis I (4/5 steps found)
- folate transformations II (plants) (8/11 steps found)
- folate transformations I (9/13 steps found)
- superpathway of L-methionine salvage and degradation (10/16 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.13
Use Curated BLAST to search for 2.1.1.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LLP1 at UniProt or InterPro
Protein Sequence (329 amino acids)
>Dshi_1677 Methionine synthase (RefSeq) (Dinoroseobacter shibae DFL-12) MTRTVIESKTKTVTIGFDEPFCVIGERINPTGRKKLAAELEAGDFSTVEKDALEQVACGA MVLDVNSGAVFTNKMAEDPRYADNNFVEPMLMKELVARVQALVDIPLCIDSSVPGALENG LEMAEGRPLLNSVTGEEDRLETILPLVKKYNVPVVAISNDDTGISEDPDVRFAVAKKIVE RAADFGIPAHDIVVDPLVMPVGAMATAGRQVFTLVARLREELGVNTTCGASNVSFGLPNR HGLGAAFLPMAIASGMTSAIMNPIRPQEMEAVHAANFLMNHDPNGATWINFARVMEAHKA GMPFPEAAKAGTSGGGGRSGRRGGRRRSG