Protein Info for Dshi_1656 in Dinoroseobacter shibae DFL-12

Annotation: ABC-3 protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 55 to 82 (28 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 264 (255 residues), 270.5 bits, see alignment E=1.6e-84 PF01032: FecCD" amino acids 46 to 262 (217 residues), 30.7 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 53% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 100% identity to dsh:Dshi_1656)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLM0 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Dshi_1656 ABC-3 protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MIDTLFAPFQFPFMQNAFLIAVLISVPTAILSCFVVLKGWSLMGDAISHAVLPGIVLAYV
LGIPLIFGAFAAGMTCALATGYLQAHSRVKQDTVMGVVFSGMFGLGLVIYTKIETNMHLD
HILFGNMLGIGSGDLATAGIIAVVVAGILLVKWRDFLLHAFDPAQARAVGLRVAWLHYGL
LALISLTIVAVLKAVGIILAIGLLIAPGAIAFLVTKRFVHMLWIAVAVTCLASISGVYAS
FWLDSAPAPTIILILSAVFVAAFVHKLWRAGRTEQRTEPLPAP