Protein Info for Dshi_1655 in Dinoroseobacter shibae DFL-12

Updated annotation (from data): glucokinase (EC 2.7.1.2)
Rationale: Specifically important for utilization of D-glucose and glucose-containing disaccharides (D-maltose, D-trehalose, and perhaps sucrose)
Original annotation: Glucokinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02685: Glucokinase
  • amino acids 10 to 318 (309 residues), 273.4 bits, E=2.3e-85
• PF00480: ROK
  • amino acids 13 to 255 (243 residues), 27.2 bits, E=2.8e-10

Best Hits

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to dsh:Dshi_1655)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• glycolysis III (from glucose) (10/11 steps found)
• homolactic fermentation (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• sucrose degradation III (sucrose invertase) (4/4 steps found)
• trehalose degradation II (cytosolic) (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation IV (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• chitin biosynthesis (6/9 steps found)
• heterolactic fermentation (12/18 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen degradation II (2/6 steps found)
• glycogen degradation I (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See A8LLL9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dshi_1655 glucokinase (EC 2.7.1.2) (Dinoroseobacter shibae DFL-12)
MTSLRDAPALVADIGGTNTRVALADGPVLRAGSVEKYRNADYSSLDSVLRSYLEKMEVAG
CSGACVALAGPVRNGIGHLTNLDWRMDEDLLSEATGAPVVALLNDLQAQGFALGHLEAAC
LRPVISRPPPAAQETRLMIGLGTGFNAASVLYTPAGRIVTPSEAGHANLPVRTEQELRLC
RFVETAHGFPAVEDVLSGRGLERVYNFLSPTPDQPQRLSAAEVMAAAAREERQALDALEL
FIGLLGTVAGNLSLIHLPFGGVYLCGGVARHIGPYLGSMGFAEAFANKGRFADFMRDFPV
WLVEDDFAALTGCASFLDERCRN