Protein Info for Dshi_1643 in Dinoroseobacter shibae DFL-12

Annotation: recA protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02012: protein RecA" amino acids 16 to 336 (321 residues), 568.8 bits, see alignment E=1.7e-175 PF00154: RecA" amino acids 19 to 281 (263 residues), 480.6 bits, see alignment E=2.5e-148 PF08423: Rad51" amino acids 51 to 239 (189 residues), 36.3 bits, see alignment E=7.7e-13 PF06745: ATPase" amino acids 53 to 242 (190 residues), 35.1 bits, see alignment E=2e-12 PF21096: RecA_C" amino acids 284 to 339 (56 residues), 90.5 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 83% identical to RECA_PARDE: Protein RecA (recA) from Paracoccus denitrificans

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to dsh:Dshi_1643)

MetaCyc: 68% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLK7 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Dshi_1643 recA protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MASASLLDVTNNRNADKQKALDSALAQIERQFGKGSIMKLGADSPVAEIEATSTGSIGLD
IALGIGGIPKGRIIEIYGPESSGKTTLTLHCIAEEQKKGGVCAFVDAEHALDPQYARKLG
VDLDELLISQPDTGEQALEITETLVRSGAVSMVVVDSVAALTPKSELEGDMGDAQVGAQA
RLMSQAMRKLTGAISRSNCTVIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRLDIRRI
GSVKDRDEIVGNTTKVKVVKNKVAPPFKQVEFDIIYGEGISKMGELIDLGVKAGVVQKSG
SWFSYGDERIGQGRENAKQYLRDNTRTALELEDKIRAAHGLDFQMPDSEAEILDD