Protein Info for Dshi_1616 in Dinoroseobacter shibae DFL-12

Annotation: Beta-ketoacyl synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 382 to 399 (18 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 1 to 239 (239 residues), 151.4 bits, see alignment E=5.5e-48 PF02801: Ketoacyl-synt_C" amino acids 247 to 359 (113 residues), 115 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 50% identical to NODE_RHILT: Nodulation protein E (nodE) from Rhizobium leguminosarum bv. trifolii

KEGG orthology group: K14660, nodulation protein E [EC: 2.3.1.-] (inferred from 100% identity to dsh:Dshi_1616)

MetaCyc: 40% identical to (5Z)-3-oxo-dodec-5-enoyl-[acp] synthase (Enterococcus faecalis)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.179, 2.3.1.41

Use Curated BLAST to search for 2.3.1.- or 2.3.1.179 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKZ4 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Dshi_1616 Beta-ketoacyl synthase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRRVVITGQGTINALGVNVAQTLEAFREGRCGISELDIRDVDRLSIRIAGQVKDYDPEAA
FNRQQISLYDRFTQFTLIAAREAIAQSGLLFSDDLASEAGVVLGTAGGGVNTWDENYRAV
YEEGKNRVHPFVVPKLMNNAAASHVSMAHNLKGPSFTVATACASSNHAMGQAFQFVRSGL
SKVMVTGGSESMLCFGGVKAWEGLRVMSKDGCRPFSANRNGMVQGEGAAVFVFEDYEHAK
ARGAEILAEVIGFSMTSDAADIVMPSKQGAARAISGAMRDARVNPDEVGYINAHGTGTAA
NDKTECAAVADAFGHHADKVMLSSTKSMHGHLIGGTGAVELLACIMALRDGIIAPTIGYE
EPDPECALDVVPNTAREAEVSVALSNAFAFGGLNAVLALRKAP