Protein Info for Dshi_1575 in Dinoroseobacter shibae DFL-12

Annotation: signal transduction histidine kinase, nitrogen specific, NtrB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00512: HisKA" amino acids 132 to 189 (58 residues), 47.6 bits, see alignment E=1.4e-16 PF02518: HATPase_c" amino acids 234 to 350 (117 residues), 73.6 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 70% identical to NTRB_RHOCB: Sensory histidine kinase/phosphatase NtrB (ntrB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to dsh:Dshi_1575)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKV3 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Dshi_1575 signal transduction histidine kinase, nitrogen specific, NtrB (RefSeq) (Dinoroseobacter shibae DFL-12)
MTQLTQALWVSLPIPALILSGENTILELNPAAENFMNGSQRSLLDAPVWDKLMVDAPLEE
AFDRVRKNLSPLFINDVDVGTGERPPVLCNIQVSPLVDNPELVLLLLEPREIAGRLGRSM
QSQSAAKSAIGMAEMLAHEIKNPLAGITGAAQLLGMNLSNEDRELTDLIVAESHRIVKLL
EQVEQFGNLRPPDLRPVNIHDVLERARRSAVVGFGAHVTIREDYDPSLPNTYADGDQLLQ
VFLNLLKNAAEACKPGGTIRIRTFYELSLRLRRKDGSGGTVPLQIEIMDDGPGLPPEIES
DVFEPFVSGRENGTGLGLALVSKIISDHDGWIAVDSVPGRTVFRISLPVAPRTEETT