Protein Info for Dshi_1574 in Dinoroseobacter shibae DFL-12

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 98 bits, see alignment E=9.5e-32 PF13191: AAA_16" amino acids 139 to 205 (67 residues), 36.1 bits, see alignment E=2.3e-12 PF00158: Sigma54_activat" amino acids 140 to 278 (139 residues), 76.5 bits, see alignment E=5.1e-25 PF14532: Sigma54_activ_2" amino acids 141 to 283 (143 residues), 90.4 bits, see alignment E=3.2e-29 PF02954: HTH_8" amino acids 403 to 440 (38 residues), 51.6 bits, see alignment 1.5e-17

Best Hits

Swiss-Prot: 80% identical to NTRC_RHOCB: DNA-binding transcriptional regulator NtrC (ntrC) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to dsh:Dshi_1574)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKV2 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Dshi_1574 two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq) (Dinoroseobacter shibae DFL-12)
MDGTVLVADDDRTIRTVLTQALTRAGCKVHATSSLMTLMRWVEEGKGDLVISDVIMPDGN
GLETLPKITEARPGLPVIVISAQNTIMTAIQAAEAEAYDYLPKPFDLPDLMKRAARALEV
KRRAPPPKLSSESPNEDLPLVGRTPQMQALYRLVARVMNTDLPVLITGESGTGKSLIARA
IHDFSDRRTLPFVVAGAADLAGADGPSTLVAKARGGSILFDEVGDLDDEAQGRIVRMLDQ
FGDNSPRIMSTSQKDLMQKMEAGIFRQDLFYRLGGVTINVPSLRERVDDIPLLATHFLAR
AERDGAPLKRLSEAASDMVRAYSWPGNVRQLENAMKRLVITAQEDEIGRADVEMVLGSQP
AIEPLMGGGEADKLSASVEKHLRRYFDLHGGVLPPPGLYQRILREVETPLIEIALDATGG
NQAKCAALLGINRNTLRKKITDLDIQVTRRRKLM