Protein Info for Dshi_1544 in Dinoroseobacter shibae DFL-12

Annotation: 3-hydroxybutyrate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 6 to 256 (251 residues), 360.9 bits, see alignment E=1.6e-112 PF00106: adh_short" amino acids 6 to 192 (187 residues), 177.4 bits, see alignment E=3.6e-56 PF08659: KR" amino acids 7 to 156 (150 residues), 33.6 bits, see alignment E=5.8e-12 PF13561: adh_short_C2" amino acids 14 to 255 (242 residues), 184 bits, see alignment E=5.4e-58

Best Hits

Swiss-Prot: 53% identical to BDHA_CUPNH: D-beta-hydroxybutyrate dehydrogenase (hbdH1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to dsh:Dshi_1544)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK87 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dshi_1544 3-hydroxybutyrate dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSLKGKTAVITGSNSGIGLGIAWELARAGADVVLNSFTDREEDHALADEIARETGVYARY
IKADMSKGDDCRALIESAGTCDILVNNAGIQHVAPIDEFPVDKWDAIIAINMNSAFHTTA
AALPMMRKAGWGRVVNIASAHGLTASPYKAAYVAAKHGVVGMTKTVALETAQEPITCNAI
CPGYVLTPLVEAQIPNTMEKYDMGREEVIKQVMLERQPSKEFATVEQLGGTCVFLCSDAA
AQITGTTISVDGGWTAL