Protein Info for Dshi_1530 in Dinoroseobacter shibae DFL-12

Annotation: transferase hexapeptide repeat containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF14602: Hexapep_2" amino acids 72 to 104 (33 residues), 28.8 bits, see alignment 8.3e-11 amino acids 109 to 120 (12 residues), 12.4 bits, see alignment (E = 1.1e-05) PF00132: Hexapep" amino acids 89 to 123 (35 residues), 36.9 bits, see alignment 2e-13

Best Hits

Swiss-Prot: 60% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1530)

MetaCyc: 39% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK73 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Dshi_1530 transferase hexapeptide repeat containing protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MIYALDGIAPQFPASGNYWVAPDANLIGKVVLEEASSVWFGATLRGDNEEIRLGTGSNIQ
EACVLHTDMGFPLTIGTNCTIGHKAILHGCTIGDGSLVGMGATILNGARIGKGCLIGAGA
LVTESKEIPDFSLVMGAPGKVVRTLDETAQAGLLESATGYQANMRRFRAGLTAL