Protein Info for Dshi_1521 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00005: ABC_tran" amino acids 18 to 175 (158 residues), 100.7 bits, see alignment E=2.2e-32 PF12399: BCA_ABC_TP_C" amino acids 227 to 251 (25 residues), 38.2 bits, see alignment (E = 1.8e-13)

Best Hits

Swiss-Prot: 42% identical to LIVG_ARCFU: Probable branched-chain amino acid transport ATP-binding protein LivG (livG) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_1521)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK64 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Dshi_1521 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MIKVENLHKHFGGFRAVDGATLEIAEGSITGLVGPNGAGKTTLFNVIAGNLQPTSGKVTM
LGEDITGLPPHDLFHKGLLRTFQIAHEFGSMTVRENLMMVPGAQSGETMWNAWFKRGQIA
REEAALGKKADEVLEFLTIDHLRDERAGNLSGGQKKLLELGRTMMVDAKIVFLDEVGAGV
NRTLLGTIADAILRLNQERGYTFCVIEHDMDFIGKLCDPVIVMAEGKKLAEGTIDEIKAN
EQVIEAYLGTGLKNKEKTPA