Protein Info for Dshi_1488 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 138 to 379 (242 residues), 54 bits, see alignment E=9.2e-19

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to dsh:Dshi_1488)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK31 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Dshi_1488 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MEPMTPLEIWIQVFIQFMPVWVMLIATFTLSIVYKRRLGLYGKLFDSPIGMVGFGIVMFW
VFTAIFADMIITHDPIQVVSGMKNKVPGTPVPEGTAGFSHYLFGGDNLARDVFSRMVMGA
REVLKIAPAATLFAFMVGIVLGLPAGYFGGKFDTVLSFIANLVLAFPVILLFYLLVTPEI
VATGIPTYMAAVLFVFPILFLVVLWNSRYFTQPAKRNLFVALTVVIGGWLYLGLAFNADP
LGIVSMPPNVLIVFVSVVFVNSPTVFRIVRGIVLDIQTRDYVAAAQTRGEGPWYIMLWEI
LPNARGPLIVDFCLRIGYTTILLGTLGFFGLGVSPESPDWGSTINEGRRLLSIYIHPALP
PALALMSLVLGLNLLADGLREESLKD