Protein Info for Dshi_1487 in Dinoroseobacter shibae DFL-12

Annotation: oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 PF00005: ABC_tran" amino acids 30 to 188 (159 residues), 99.9 bits, see alignment E=7.2e-32 amino acids 383 to 535 (153 residues), 116.6 bits, see alignment E=4.9e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 238 to 326 (89 residues), 60.6 bits, see alignment E=1.9e-20 amino acids 585 to 676 (92 residues), 79.2 bits, see alignment E=2.9e-26 PF08352: oligo_HPY" amino acids 239 to 303 (65 residues), 54.9 bits, see alignment E=3.1e-18 amino acids 587 to 650 (64 residues), 56.8 bits, see alignment E=8.2e-19

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_1487)

Predicted SEED Role

"Oligopeptide/dipeptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK30 at UniProt or InterPro

Protein Sequence (693 amino acids)

>Dshi_1487 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTETYDGPILEIENLSISFFTRLREIPAVMDFSCTVMPGEAMGLVGESGCGKSTVALGVM
QDLGVNGRIVGGTIKFKGRDLNTMSPEELRRIRGKEIAMIYQEPMASLNPAMRIGKQLME
VPMIHEGVSEDVAYQRALDVVTDVRLPDPKRILNSFPHQLSGGQQQRIVIAMALMANPAL
LILDEPTTALDVTVEAAVVDLVKDLGKKYGTSMLFISHNLGLILETCDRLCVMYSGEAVE
TGSIEDVFDEMQHPYTQALFRSIPLPGADKNARPLVAIPGNFPLPHERPKGCNFGPHCDY
FQPGLCDAQDIRMRKIPGDDRHGSRCLRFEEIDWNAPVEKADQTEKPEPGRVVLNMDNLK
KYYEVAASALFGGKNKKVVKANEDLSFEAREGETLAIVGESGCGKSTFAKVLMGLETATD
GTILLDNREIQDIEIQDRDTKTVADVQMVFQNPFDTLNPSMTVGRQIIRALEIFGVGDTE
DARKQRMLELLDLVKLPRAFANRMPRQLSGGQKQRVGIARAFAGDARIVVADEPVSALDV
SVQAAVTDLLMEIQRQNQTTLLFISHDLSIVRYLSDRVMVMYLGHVVELGTTDEVFSPPY
HPYTEALLSAVPIADTSIQKERIVLDGDIPSAMNPPPGCPFQTRCRWKSEVPGNLCETQV
PPQRKTPTGHQIKCHLSEESFARMGPVIKMAAE