Protein Info for Dshi_1486 in Dinoroseobacter shibae DFL-12

Annotation: BCCT transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details amino acids 499 to 521 (23 residues), see Phobius details amino acids 543 to 564 (22 residues), see Phobius details amino acids 570 to 593 (24 residues), see Phobius details PF02028: BCCT" amino acids 30 to 332 (303 residues), 281.9 bits, see alignment E=4.1e-88 amino acids 401 to 594 (194 residues), 204.8 bits, see alignment E=1e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1486)

Predicted SEED Role

"Glycine betaine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK29 at UniProt or InterPro

Protein Sequence (621 amino acids)

>Dshi_1486 BCCT transporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MPVKPPVTDLPIRTADSGFYKGFTKDVAITGKLLVGGLILWAIAFPDQAASVLGALNSII
LATFNIWYVYTMAFFVILCFALALWPTAGKLRLGHDDDRPEFSNFSWFSMMFGAGIGIGM
LTFATAEPMYHFGANPATIMGDTEGSTAGNVRDAYIWSFTHWGLAAWASYAIVGLALGYF
CYRRGLPLTIRSALTPIFGNKLSGPVGHVVDIVAVVATVLGVSQTLGFGVEQFIAGLSRI
GVGDWLYTATADGGQTSSTMGIIVALCVIMGLSTLSALSGVGKGIKWLSNLNMGLSFFVL
IFFLIFGSTFFGLQTLFVGMFDYLVSIPGNIFTVWVGAPAEAIIASVPASVQALPAEDLA
AMVESATSPWGTLASFTEGLPASAAALPAADIAAVYAAATENRLSGWQGAWTIFYWAWWI
AFAPFVGVFLARISKGRTVREYVLGAMIIPAIMCFVWFALVGGTAIDLELRGVADGAIQG
AGQADQLFAMLAVMLSEGLAYAMSVLIVILLLTYLVTSADSAVLIINTINAAGDEGPKAR
PHILFWGAALALVVGGLIIAGGLGAIQTAMVIGALPFSVVMVLMGLSLIKAVYRDGLRLK
HGLPATHVEPADTDAAPTPAE