Protein Info for Dshi_1479 in Dinoroseobacter shibae DFL-12

Annotation: Exopolysaccharide synthesis ExoD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 62 to 70 (9 residues), see Phobius details amino acids 129 to 166 (38 residues), see Phobius details amino acids 169 to 201 (33 residues), see Phobius details PF06055: ExoD" amino acids 10 to 186 (177 residues), 196 bits, see alignment E=1.9e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1479)

Predicted SEED Role

"Exopolysaccharide synthesis protein ExoD-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK22 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Dshi_1479 Exopolysaccharide synthesis ExoD (RefSeq) (Dinoroseobacter shibae DFL-12)
MPSSPEHFAISHRLHQLAADANGPSVSLGWVMSQLHERAFGLFLLILALPCCIPFLYGIP
QIVALPLMFVSAQILFGRQTPWLPERLSTREVQTEALSRLAARAEPWLHRIEAVSRPRLA
ALTHGPADRIVGLALVLFSASILVPLPSTNTVPGFAVVIIAMGLLQRDGILVILGTLLGT
AWIGALIVAGATLISLLTSWIGL