Protein Info for Dshi_1478 in Dinoroseobacter shibae DFL-12

Annotation: Disulphide bond formation protein DsbB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details PF02600: DsbB" amino acids 6 to 147 (142 residues), 125.4 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1478)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK21 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Dshi_1478 Disulphide bond formation protein DsbB (RefSeq) (Dinoroseobacter shibae DFL-12)
MLDNPRTLAVLAAGGSLALLLAAWGFQYLGGLAPCAMCVWQRWPHALAVAAGGLALVTPL
AAWLGLGGALATAGIGGYHTGVERGWWEGPSTCSSGEIGGLSPDELLAQIMEAPLVRCDE
VAWQMLGLSMASWNVVLSLGLAGLWALALLRARRA