Protein Info for Dshi_1450 in Dinoroseobacter shibae DFL-12

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 226 to 266 (41 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF05940: NnrS" amino acids 23 to 397 (375 residues), 258.4 bits, see alignment E=7.3e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1450)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJH0 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Dshi_1450 NnrS family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSCGPATGHDRPLPRGWRATLGDEGFRLFFALGALYAALFPLLWVVAWGLSLPLAQAVPP
GLWHAHEMLIGAFGAALIGFVTTAAPEWTDTAPPRGRPLWALAGLWGLGRLVGLPGWEAA
GLLGALADLGWMLALIAWLVALSVRRRTDRLFAFIFWLALLAATTATARLGFATGDLARA
TLGLHLAGFAFLGLLGLALSRITAPITNLVLDPTERTSPFRPHPGRLHLAPGLVLLAMAG
EALGVSAAVSAWLLIAAGAAFMDRVGEAFIGREAARTEILMLAGSSALAGLGLMLAGAAR
LGAPWPDVTGLHIAFMGGLGLGVYAVYCIAGCLHTGQPLGLSRPARLGACALVAAVLLRV
APDFGINLPLPTMALAATAWGGGFLLWLAAYWPALSRIAPPVAQPGSAEAALPPTAAAPY
PAAAE