Protein Info for Dshi_1429 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 13 to 198 (186 residues), 179.9 bits, E=6.4e-57
• PF08659: KR
  • amino acids 14 to 162 (149 residues), 37.2 bits, E=4.3e-13
• PF13561: adh_short_C2
  • amino acids 19 to 254 (236 residues), 200.6 bits, E=4.6e-63

Best Hits

Swiss-Prot: 50% identical to TSAC_COMTE: 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 (tsaC1) from Comamonas testosteroni

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to dsh:Dshi_1429)

MetaCyc: 50% identical to 4-sulfobenzyl alcohol dehydrogenase subunit (Comamonas testosteroni T-2)
1.1.1.M5 [EC: 1.1.1.M5]; 4-(hydroxymethyl)benzenesulfonate dehydrogenase. [EC: 1.1.1.M5, 1.1.1.257]

Predicted SEED Role

"toluenesulfonate zinc-independent alcohol dehydrogenase" in subsystem Toluene degradation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 4-toluenecarboxylate degradation (1/3 steps found)
• 4-toluenesulfonate degradation I (1/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• biotin biosynthesis I (8/15 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.257 or 1.1.1.M5

Sequence Analysis Tools

See A8LJE9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Dshi_1429 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MTETNTSRRLSGKTAIVTGAASGFGREIARRFVREGARVAIVDLNGEGAKAVADALQQNA
IAVTCDVSKGADVSRAVQETIDAFGRVDIAINNAGWSHRNQPALDVDFETFKRVYEVNVD
SIFHATHALVPHWRDIGGGVMINVGSTAGIRPRPGLSWYNSSKGAVNMMTKTLAVELAPD
RVRVCGLAPVMGATPLLETFMGMPDTPENRAKFLGTIPLGRLCEPEDMANAALYLASDEA
NFITGVILEVDGGRTV