Protein Info for Dshi_1387 in Dinoroseobacter shibae DFL-12

Annotation: ATP-dependent Clp protease, ATP-binding subunit ClpX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 9 to 407 (399 residues), 653.1 bits, see alignment E=9.1e-201 PF06689: zf-C4_ClpX" amino acids 13 to 49 (37 residues), 70.8 bits, see alignment 2.4e-23 PF07724: AAA_2" amino acids 109 to 306 (198 residues), 120.9 bits, see alignment E=2.1e-38 PF01078: Mg_chelatase" amino acids 109 to 142 (34 residues), 20.8 bits, see alignment 8e-08 PF07728: AAA_5" amino acids 111 to 187 (77 residues), 25.1 bits, see alignment E=5.6e-09 PF00004: AAA" amino acids 112 to 229 (118 residues), 61.8 bits, see alignment E=3.4e-20 PF10431: ClpB_D2-small" amino acids 312 to 383 (72 residues), 44.8 bits, see alignment E=3.6e-15

Best Hits

Swiss-Prot: 100% identical to CLPX_DINSH: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to dsh:Dshi_1387)

MetaCyc: 69% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJA7 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Dshi_1387 ATP-dependent Clp protease, ATP-binding subunit ClpX (RefSeq) (Dinoroseobacter shibae DFL-12)
MANNSGDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREETKSSGLKSSE
GVPTPQEICDVLDDYVIGQSHAKRVLSVAVHNHYKRLNHAGKTDIELAKSNILLIGPTGC
GKTLLAQTLARILDVPFTMADATTLTEAGYVGEDVENIILKLLQASEYNVERAQRGIVYI
DEVDKITRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTTNI
LFICGGAFAGLEKIIAQRGKGSAIGFGADVKENDTRGVGEMFGELEPEDLLKFGLIPEFV
GRLPVIATLTDLDEDALVTILTQPKNALVKQYQRLFELEDAQLTFTEDALNAIAGRAIER
KTGARGLRSILEDILLNTMFDLPGLDNVDEVVVNEEVVSGDAQPLLIYAERKEEPATVG