Protein Info for Dshi_1382 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 268 (172 residues), 75.9 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to dsh:Dshi_1382)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJA2 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dshi_1382 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MSLADPSPLVDTPDADEQARLRARRIERIGKWSLPVIVMALGIFLWDRIVVWNEIPHYIL
PGPGRVLDTLIADWGILYEASLLTARTTILALLLAVIGGAGLAILFNQSKMVEMSFYPYA
VILQVTPVVSIAPLIFIYVDSKTAGMLLCAWIVAFFPVLSSTTLGLNSVDHNLRDLFRIY
GATRWQKLWMLQLPSALPYFLGGLKIAGGLSLIGAVVAELVAGTGGVGAGLAARIQEAGY
RLNIARMFAALSLVAAMGVFIFAALSVLSHMLLHKWHESALTREG