Protein Info for Dshi_1372 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 103 to 131 (29 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 119 to 301 (183 residues), 82.7 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to dsh:Dshi_1372)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 1" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ92 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Dshi_1372 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MRLILPVLTVVAALVALWYIAAVPMNIKGVLVEAERAGAEVTPPGAAERRDMRSFALVAQ
NGFAIPATWAQERPRLPAPHQVAVELWETTVEKRITSKRSLIYHAWITLSATLLGFAIGS
AAGVLLAVGILYNRAMDMSVMPWAIASQTIPILAIAPMIIVVLNSVGVQGLLPKAMISAY
LSFFPVVVGMVKGLRSPDAMQLDLLRTYNASPSQGFWLLRLPASMPYFFTSLKIAAAASL
VGAIVGELPTGAVAGLGARLLAGSYYGQTIQIWSALFGAAILAAVLVGIIGLIQRITLKR
MGLSQ