Protein Info for Dshi_1363 in Dinoroseobacter shibae DFL-12

Updated annotation (from data): Dihydropyrimidine dehydrogenase (NADP(+)) (EC 1.3.1.2)
Rationale: Specifically important for utilizing Uridine. Automated validation from mutant phenotype: the predicted function (1.3.1.2) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: dihydroorotate dehydrogenase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF01180: DHO_dh" amino acids 4 to 306 (303 residues), 103.7 bits, see alignment E=5e-33 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 6 to 320 (315 residues), 170.8 bits, see alignment E=1.8e-54 PF01207: Dus" amino acids 119 to 183 (65 residues), 27 bits, see alignment E=1.1e-09 PF12837: Fer4_6" amino acids 338 to 362 (25 residues), 26.6 bits, see alignment (E = 2e-09) PF14697: Fer4_21" amino acids 338 to 396 (59 residues), 84.1 bits, see alignment E=2.7e-27 PF13237: Fer4_10" amino acids 338 to 389 (52 residues), 26.1 bits, see alignment 3.2e-09 PF12838: Fer4_7" amino acids 345 to 390 (46 residues), 31.7 bits, see alignment 8e-11

Best Hits

Swiss-Prot: 44% identical to PREA_SALTY: NAD-dependent dihydropyrimidine dehydrogenase subunit PreA (preA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1363)

MetaCyc: 58% identical to (NADP)-dependent dihydropyrimidine dehydrogenase (Brevibacillus agri)
Dihydropyrimidine dehydrogenase (NADP(+)). [EC: 1.3.1.2]; 1.3.1.2 [EC: 1.3.1.2]

Predicted SEED Role

"Dihydropyrimidine dehydrogenase [NADP+] (EC 1.3.1.2)" in subsystem Pyrimidine utilization (EC 1.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIZ1 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Dshi_1363 Dihydropyrimidine dehydrogenase (NADP(+)) (EC 1.3.1.2) (Dinoroseobacter shibae DFL-12)
MADLRSDFVGVKSPNPFWLASAPPTDKEYNVRRAFEAGWGGVVWKTLGFDPHVVNVNGPR
YGAVWGADRRLLGLNNIELITDRPLEVNLREIKQVKRDYPDRAMVVSLMVPCEEDPWKKI
LPLVEETGADAVELNFGCPHGMSERGMGSAVGQVPEYIEMVARWCKQHTRMPVIVKLTPN
ITDIRYPARAAHAGGADAVSLINTISSITSVNLDSFSPEPSIDGKGSHGGYCGPAVKPIA
LNMVAEIARDAETAGMPISGIGGVTTWRDAAEFLALGAGNVQVCTAAMTYGFKVVQEMIS
GLSQYLDEKDMTLDDLIGRATPNVTDWQYLNLNYVTKARIDQDSCIKCGRCYAACEDTSH
QAISMSADRVFEVIDAECVACNLCVNVCPVEDCITMVEMQPGEVDPRTGKVVEKDYANWT
THPNNPASQAAE