Protein Info for Dshi_1333 in Dinoroseobacter shibae DFL-12

Annotation: DEAD/DEAH box helicase domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00270: DEAD" amino acids 26 to 194 (169 residues), 163.3 bits, see alignment E=6.5e-52 PF04851: ResIII" amino acids 40 to 188 (149 residues), 32.9 bits, see alignment E=8.8e-12 PF00271: Helicase_C" amino acids 239 to 349 (111 residues), 112.5 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1333)

Predicted SEED Role

"ATP-dependent RNA helicase Atu1833" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIW1 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Dshi_1333 DEAD/DEAH box helicase domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTKFSDLNLDPKVLKAISEAGYDTPTPIQAEAIPPALEGRDVLGIAQTGTGKTASFTLPM
ITMLRKGRARARMPRSLVLAPTRELAAQVAENFDIYAKHTKLTKALLIGGVSFKEQDLLI
DKGVDVLIATPGRLLDHFERGKLILTDVKVMVVDEADRMLDMGFIPDIEKIFQLTPFTRQ
TLFFSATMAPEIERITNTFLSNPARVEVARQSTTSETITQGLVQFKPSRRDRATAFKEKR
EMLRALIEREGDGCRNAIIFCNRKMDVDVVAKSLIKHGYDAAPIHGDLEQSQRTKTLDQF
RDGTLKFLVASDVAARGLDIPNVSHVFNFDVPSHAEDYVHRIGRTGRAGRKGTTLMLAVP
ADDKLLAAIEDLVKLEIPRIEAPGISAPQGGRSKDEERPEPEKRERRSRRRTKPEPAKAN
APAQAPVAAQAETAVAEAEEAPIPDAVLPAARKTETPQRGRKGRARDTGPKQVGLGDHVP
DFLLRSFSERSTT