Protein Info for Dshi_1308 in Dinoroseobacter shibae DFL-12

Annotation: NADH-quinone oxidoreductase, B subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 30 to 171 (142 residues), 244.3 bits, see alignment E=1.8e-77 PF01058: Oxidored_q6" amino acids 56 to 165 (110 residues), 103.7 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 100% identical to NUOB_DINSH: NADH-quinone oxidoreductase subunit B (nuoB) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to dsh:Dshi_1308)

MetaCyc: 58% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIT6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Dshi_1308 NADH-quinone oxidoreductase, B subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MGVSTAAYDAGPDKEHATQLLNNELQDKGFLLTSTEDIINWARTGSLHWMTFGLACCAVE
MMHTSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGS
CANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGLLQLQRKIRRTGTIVR