Protein Info for Dshi_1294 in Dinoroseobacter shibae DFL-12

Annotation: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF01128: IspD" amino acids 3 to 122 (120 residues), 31.7 bits, see alignment E=3.4e-11 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 4 to 435 (432 residues), 476.5 bits, see alignment E=4.4e-147 PF12804: NTP_transf_3" amino acids 6 to 133 (128 residues), 67.3 bits, see alignment E=4.6e-22 PF00483: NTP_transferase" amino acids 6 to 205 (200 residues), 34.2 bits, see alignment E=5.2e-12 PF00132: Hexapep" amino acids 265 to 299 (35 residues), 29.8 bits, see alignment 8.8e-11 PF14602: Hexapep_2" amino acids 378 to 412 (35 residues), 26.2 bits, see alignment 1.4e-09

Best Hits

Swiss-Prot: 100% identical to GLMU_DINSH: Bifunctional protein GlmU (glmU) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to dsh:Dshi_1294)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIS2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Dshi_1294 4-diphosphocytidyl-2C-methyl-D-erythritol synthase (RefSeq) (Dinoroseobacter shibae DFL-12)
MGVALIVLAAGQGSRMNSELPKVLHPLAGAPLLAHGLRAGAALDPARIVVVTGHGAAAVE
AATAQLAPEAICVRQTEQLGTGHAVAQTAQALAGFGGDALVLYGDTPFISPETLLAMQAA
RAAGADMVVLGFEAADPGRYGRLVTDGDALLRIVEAKDATPDELALDLCNSGVMMADAQV
LLRLVAGLSNDNASREYYLTDTIAAGRAEGLRARVVVCPEAETLGINTRTELAAAEQAFQ
ARARARALEDGVTLADPATTHFAVDTVIGRDATIGPQVVFGPGVTVESGAEIRAFSHLEG
CHVSRGARVGPFARLRPGAELAENTHVGNFVEIKNATLAQGAKVNHLSYIGDAAIGEASN
VGAGTITCNYDGVFKHRTEIGARSFIGSNTCLVAPVRVGDEAMTATGTVVTQDIPDGAMA
VGRTRQENKPGFARKFMTMLRARKSAKGAQ