Protein Info for Dshi_1247 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 301 (205 residues), 61.8 bits, see alignment E=3.6e-21

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to dsh:Dshi_1247)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LID5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Dshi_1247 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSSDLSEVRSLAGGSWWHRNQQALTPILFLIPGILFFAVYVIIPIFQSFQISLLEWDGL
GEPEFVGLRNYDELRYDDAFYTSLKNNIIWLALYLLAIPAGLFIALFLNQTVTGIRLYKS
LFFFPFVISQVVVGLVFTWFYDPNFGMLNTMLGWVGLGPIAVLGDERYVTIGIIAAGLWP
QTAYCMILYLTGLNAVDPEQIEAGRLDGAKGWRMLWHVVLPQLRPATFIAFVVTIIGALR
SFDLISIMTQGGPFGSSRVLSFYMFEVALSEYGFRMGYGAAIAVVLFLIMMVFITGFLVK
MYRDERGY