Protein Info for Dshi_1246 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 260 (163 residues), 60.4 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to dsh:Dshi_1246)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmG" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LID4 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Dshi_1246 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MFPRPIEKAPRAAQLTYQGMIPLALILWLLPLIAVAIFSVKPAGDFAAGNYWGWPAEFAG
FENYARVFTDSEMPRYILNSFMITIPTVIGAVALSCMTGFALGIYRFRGNLLIFFMFIAG
NFVPFQILMVPVRDLTVDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPYELIEAAR
VEGVAEWRIFWFVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGPNAQPVTAGITSFN
AQFGIAYNMLSAGSLIAALPPVMMFFLMQKHFIAGLTLGAVK