Protein Info for Dshi_1149 in Dinoroseobacter shibae DFL-12

Annotation: translation initiation factor IF-3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF05198: IF3_N" amino acids 39 to 108 (70 residues), 119.8 bits, see alignment E=4.6e-39 TIGR00168: translation initiation factor IF-3" amino acids 39 to 202 (164 residues), 237 bits, see alignment E=4.4e-75 PF00707: IF3_C" amino acids 115 to 199 (85 residues), 133 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 88% identical to IF3_RUEPO: Translation initiation factor IF-3 (infC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to dsh:Dshi_1149)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHU4 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dshi_1149 translation initiation factor IF-3 (RefSeq) (Dinoroseobacter shibae DFL-12)
MHPPERLPSASQKVNDTRTKPIARRPHNAPPQRDTGPRVNGRIRAPEIRLIDADGENAGV
VTPREAMRMAEEAGLDLVEISPNANPPVCKIMDFGKFKYEQQKRESEARKKQKTIDVKEV
KFRPNTDTHDYQVKMRNVFKFLEGGDKVKVTLRFRGREMAHQNLGRELLERVAEDTKEIG
KVENMPKMEGRQMVMMIGPLAK