Protein Info for Dshi_1141 in Dinoroseobacter shibae DFL-12

Annotation: protoheme IX farnesyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 123 to 151 (29 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 236 to 253 (18 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 33 to 313 (281 residues), 329.4 bits, see alignment E=1.2e-102 PF01040: UbiA" amino acids 46 to 298 (253 residues), 211.7 bits, see alignment E=5.7e-67

Best Hits

Swiss-Prot: 100% identical to COXX_DINSH: Protoheme IX farnesyltransferase (ctaB) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to dsh:Dshi_1141)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1, 2.5.1.-

Use Curated BLAST to search for 1.9.3.1 or 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHT6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dshi_1141 protoheme IX farnesyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRAGPFRESQRDPMSDASFDRSMPLSGEGSFGDYFALLKPRVMSLVVFTALVGLLVAPVS
LHPMVGFCAILFIAVGAGASGALNMWWDADIDVIMKRTAGRPVPAGKVQPGEALALGLGL
SGLSVVMLALATNLLAAGLLAFTIFFYAVVYSMWLKRSTPQNIVIGGAAGAFPPMIGWVA
ATGSVSLEAVLMFALIFMWTPPHFWALALFMKSDYHDAGVPMLTVTHGRKSTRTHILVYT
VLLVPVALGLALTPVAGPLYLATALVLNAIFLKGAWDIWRRDEAQAEADKYATEKRFFKF
SLLYLALHFTALLAEAILTRSGLWTFGG