Protein Info for Dshi_1140 in Dinoroseobacter shibae DFL-12

Annotation: Cytochrome c oxidase subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 45 to 67 (23 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details PF02790: COX2_TM" amino acids 22 to 108 (87 residues), 74.4 bits, see alignment E=6.5e-25 TIGR02866: cytochrome c oxidase, subunit II" amino acids 33 to 251 (219 residues), 194.7 bits, see alignment E=6.3e-62 PF00116: COX2" amino acids 120 to 242 (123 residues), 154.6 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 57% identical to COX2_PARDE: Cytochrome c oxidase subunit 2 (ctaC) from Paracoccus denitrificans

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to dsh:Dshi_1140)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHT5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Dshi_1140 Cytochrome c oxidase subunit II (RefSeq) (Dinoroseobacter shibae DFL-12)
MAALGAPAFADNREGMEIIGQPIPGGIGFQPAATELARELQWLDGLLLVIITAIVLFVTA
LIAWTIVRHNAKSNPEPARFSHNTPIEITWTVVPILILVFIGAFSLPVLFKQQEIPEAEV
TIKATGYQWFWGYEYPEHDFGFESFMLARDELAEHGYEDEHFLLATDTAMVVPVDTTVVV
QVTAADVIHSWTIPAFGVKQDGIPGRLAELWFSAEKEGIYFGQCSELCGKDHAYMPITVK
VVSKEEYARWLDTAIAQYNGTPRTVDYAAK