Protein Info for Dshi_1138 in Dinoroseobacter shibae DFL-12

Annotation: DNA protecting protein DprA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF21102: DprA_N" amino acids 23 to 81 (59 residues), 60.7 bits, see alignment E=1.6e-20 TIGR00732: DNA protecting protein DprA" amino acids 86 to 297 (212 residues), 226.6 bits, see alignment E=1.1e-71 PF02481: DNA_processg_A" amino acids 87 to 289 (203 residues), 234.1 bits, see alignment E=1.5e-73 PF17782: DprA_WH" amino acids 310 to 373 (64 residues), 63.3 bits, see alignment E=2.7e-21

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to dsh:Dshi_1138)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHT3 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Dshi_1138 DNA protecting protein DprA (RefSeq) (Dinoroseobacter shibae DFL-12)
MAKDIAPLFPDDDTPQAPRSVDEALDWLQLIRSPRVGPVTFHKLLAEYGTARAALDALPE
VGSAAGLKDLRPIARDRVEKEYTTGRKMGARLAALGGTLYSDRLSSIDDAPPLLWCLGDV
ELLKRSAVALVGARNASAIGQRLARAFAKGLGSEDQVIVSGLARGIDAAAHDAAIDTGTI
AVVAGGLDVIYPKENTELFKRIAKQGLIVSEQPLGMQPQARHFPRRNRLISGLARAVVVV
EATVKSGSLLTARDAADQGREVMAAPGHPFDGRASGCNQLLRDGATLVRNAEDILLALSP
EAAAPSPEPAAAPAPELGRPSADELRGRVLATLGATPLPEDQVIRALGLPAAQVNAALVE
LEMSGQITRAPGGMLSLGC