Protein Info for Dshi_1135 in Dinoroseobacter shibae DFL-12

Annotation: putative signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00989: PAS" amino acids 23 to 123 (101 residues), 24.7 bits, see alignment E=4e-09 PF13426: PAS_9" amino acids 25 to 125 (101 residues), 67.1 bits, see alignment E=2.9e-22 TIGR00229: PAS domain S-box protein" amino acids 34 to 125 (92 residues), 37.4 bits, see alignment E=1.2e-13 PF13581: HATPase_c_2" amino acids 233 to 330 (98 residues), 32.2 bits, see alignment E=1.9e-11 PF02518: HATPase_c" amino acids 243 to 336 (94 residues), 33.6 bits, see alignment E=9.2e-12

Best Hits

Swiss-Prot: 42% identical to LVHK2_ERYLH: Blue-light-activated histidine kinase 2 (ELI_04860) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1135)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHT0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Dshi_1135 putative signal transduction histidine kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MKPRTLGTVLDDREALAGFSRARVAMVLTNPNIHDNPIVYVNDAFERVTGYSRTAAIGRN
CRFLQGSMTDDADVAKLRRAIEREEDVTVDILNYRASGEPFLNRLIIAPVKSDDGKCHYF
IGIQKAMSDRDIDSSTLSIEKQLNAVQRRVRQDLSMLIDIIRDQSNRMGSEEGFAALARR
IECLQLLYEEMRLSDRDAHRQGISMGSYLTRVANAIAHSDGRPGVAFSIEVGRFEADLET
ATRTGLILSEVLTNAFQHAFVGLDAGTVRMEVIALTEGGFRVVISDDGVGIPKDMPVPAT
QTLGGRIATELIDSLEGTLNYVRGAAGTVVIIDVPAGN