Protein Info for Dshi_1123 in Dinoroseobacter shibae DFL-12

Annotation: Tetratricopeptide TPR_2 repeat protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13432: TPR_16" amino acids 38 to 98 (61 residues), 25.4 bits, see alignment E=9e-09 amino acids 105 to 147 (43 residues), 16.2 bits, see alignment E=6.8e-06 PF13181: TPR_8" amino acids 65 to 97 (33 residues), 14.2 bits, see alignment 2.3e-05 amino acids 101 to 130 (30 residues), 21.2 bits, see alignment 1.3e-07 PF13431: TPR_17" amino acids 87 to 118 (32 residues), 24.9 bits, see alignment 9.2e-09 PF07719: TPR_2" amino acids 101 to 132 (32 residues), 26.5 bits, see alignment 2.4e-09 PF13176: TPR_7" amino acids 102 to 131 (30 residues), 16.9 bits, see alignment 3e-06 PF13374: TPR_10" amino acids 103 to 127 (25 residues), 16.6 bits, see alignment 3.4e-06

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1123)

Predicted SEED Role

"Flp pilus assembly protein TadD, contains TPR repeat" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHR8 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Dshi_1123 Tetratricopeptide TPR_2 repeat protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MAACTDVPSDEGAFPVDGPFPPTALASDGAAVDGVLVGNRLMQAGEYELALRAFFRAGAE
QGMTAEILSGIGSANLKLGRLNQSETLLRRAVEEYPDYVPGWNNLGVLLMEKGDYGEASR
VFRQAFALDSGNSDDIRNNLSLALEKRDALRYSQPSENKEFDLVWQGNGSYALISP