Protein Info for Dshi_1013 in Dinoroseobacter shibae DFL-12

Annotation: apolipoprotein N-acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 469 to 489 (21 residues), see Phobius details PF20154: LNT_N" amino acids 19 to 175 (157 residues), 79.1 bits, see alignment E=4.3e-26 TIGR00546: apolipoprotein N-acyltransferase" amino acids 63 to 442 (380 residues), 247.8 bits, see alignment E=1.1e-77 PF00795: CN_hydrolase" amino acids 243 to 464 (222 residues), 82.5 bits, see alignment E=3.2e-27

Best Hits

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to dsh:Dshi_1013)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSE1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Dshi_1013 apolipoprotein N-acyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MARSPVLARWPRLADVLCGLAIGLGQAPLGLWPLALLGLAGLLARLDRSSGWRAGAWTAW
RAGAAYFALTLHWIVEPFLVDVARHGWMAPFALVLMAGGLALFWAAAGALAGGLRPGLPR
GLGFALALMSAEMLRSYVFTGFPWALIGTIWIDTHAAQTAAFWGLHGLGLATLCILVLAR
AQPLGRGLATGAAGLALLTGLGMLRPDPPAIPPDAPVLRLVQPNAAQHLKWDPGMIPIFY
ARLLDLTARPAPGAPPALVIWPETAIAYRLENAGPLLSQIAETAGDAPVVLGAVRGTPAG
ATNALAVLDATGIPAQIYDKAHLVPFGEYVPFGDLAARLGIRGLAVAEGGGFLAGPGPQV
LDFGPLGRALPLICYEAIFPNFGRARLAEADWMLQITNDAWFGQFAGPQQHLVLARFRAI
ERGMPLVRAANTGISTVIDPTGALTGALPLGVAGTLDAALPPALATPPYARLGDLPLLIA
MIVSLLGLMTRSRARAH