Protein Info for Dshi_0972 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 72 to 97 (26 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 258 (169 residues), 57.2 bits, see alignment E=9.7e-20

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 100% identity to dsh:Dshi_0972)

MetaCyc: 66% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LS07 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Dshi_0972 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MARAVTQQRKLINTTLAWGIGLLIFFPILWTILTSFKTEATAIADPPVFLAFDWTLENYT
AVLERSNYAKFLWNSIIIAGGSTILGIMIAVPAAWSMAFVPSRRTKDILLWMLSTKMLPA
VGVLYPIYLICIELGILDSRVALVVILMLMNLPIIVWMLYTYFKEIPGEILEAARMDGAS
LKEEILYVLTPMAIPGIASTLLLNFILAWNEAFWTLNLTAANAAPLTAFIASYSSPEGLF
FAKLSAASTMAIAPILILGWFSQKQLVSGLTFGAVK