Protein Info for Dshi_0918 in Dinoroseobacter shibae DFL-12

Annotation: Auxin Efflux Carrier (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 6 to 306 (301 residues), 95.4 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to dsh:Dshi_0918)

Predicted SEED Role

"malonate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRV6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Dshi_0918 Auxin Efflux Carrier (RefSeq) (Dinoroseobacter shibae DFL-12)
MTILLEVTLPIFLVLAAGYGAVWAKVFSDENVEALMRFTQNFAIPCLLFLAISTLDLDAV
FDWRLLTSYYSGSLASFATGILGARFLFARPMQDAVAIGFCCMFANTVLLGIPILERAHG
LPALEPLYAIIAIHAPFGYLVGITTMEIVRASSKNVFVTVGAILKTMSQNALMIGIALGF
AVNLSGLMPPAVAIEAIEMIARAGIPAALFGLGGVLFRYKPEGNLREVAFVCLVSLMLHP
LVAWAMSRLVFGLDDPMIRAAALTAAMAPGVNTYIFANMYGVAKRVVATAVLAGTALSIL
LAAFWLSVLP