Protein Info for Dshi_0917 in Dinoroseobacter shibae DFL-12

Annotation: acriflavin resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1054 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 470 to 493 (24 residues), see Phobius details amino acids 533 to 555 (23 residues), see Phobius details amino acids 876 to 895 (20 residues), see Phobius details amino acids 902 to 922 (21 residues), see Phobius details amino acids 933 to 955 (23 residues), see Phobius details amino acids 981 to 1000 (20 residues), see Phobius details amino acids 1007 to 1029 (23 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1034 (1031 residues), 663.4 bits, see alignment E=5.8e-203 PF03176: MMPL" amino acids 347 to 493 (147 residues), 37 bits, see alignment E=2e-13 amino acids 845 to 1033 (189 residues), 43.5 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 100% identity to dsh:Dshi_0917)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRV5 at UniProt or InterPro

Protein Sequence (1054 amino acids)

>Dshi_0917 acriflavin resistance protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MNPIRFSIERPIAVIAAVIMAILFGIIALSRIPIQLAPDVRKPVVVIETNWPGAAPAEVE
REIINPQEEALRGLDGLDIMTSRSQSGSGEITLEFAPGTDMSQTLLLVSNRLDRVGDYPA
EASEPSLDTSGDDDSPIAWVIVTDAGTAQRPLPTYGDFMEDVVKDRIERIEGVSAVNVFG
GVSRELQIVVDPRRLALFGLTVPEVVARLRSENISLSAGDVEEGKRRYIVRAEGALDTVE
AVGGVVLRSEASSGTLGRVLVRDVAEVQFDYGEPTARLRFKGESGLAFNIVRDRGANVIE
TMEEVRRVLGELQEGPVAAQGLSLEQVYDETIYIEGAIALVTQNIWIGGALAALVLLIFL
RSPRATLVVSLAIPVSIVATFVAMAATGRTLNVVSLAGIAFAVGMIVDAAIVVLENIYRL
REQGKSRSEAAYLGARQVWGAILVSALTTVLVFVPILIMELEAGQLFRDIAVAISVSVLL
SLVVAVTVIPALAKRLLKDGQQTTLPLWGIDHFARGFKAAVMWYVRMTVRFRALGILMVG
LIGGTAAVATVVFLPRLEYLPEGNRNLVFGLIIPPPGYNLDTTETIAERIERAARPMWEA
APALETPEGTPTVENFFFVATPGNSFVGATALDGPRVAELIPLLSGPIFAEPGTFGFMTQ
PSLFGRGVGGGRTIELNVSGQDLEQILGVAGRAAGLVAGLLPRSEGHQFRPIPGLELGAP
EVRLVPDRLALADAGLDAGALAATVDAYNDGLRVAEITEGADRLDLVLKGDTSLSAGFRT
QDVGSYPVVTPSGDIVPVSALADVIVTAGPTEIRHRDRLRTVTLEVRPSDALPLEAAVEL
LQTEVVAVLEGQGVPPGIRLTVSGTADQLSQTWEAIQINLVVALVIVFLVMAILFESFVL
PLVILISVPVAAAGGVGGLALLNTFQTQPLDMLTLLGFIILVGIVVNNAILIVHQSLYHL
REEGMSPVDAIEEATRNRIRPIFMSTLTSIMGMLPLVVFPGEGSELYRGLGAVVVGGLSM
SAFLTLLTVPPLLRLCLKAPSPEEVPVLQAQPAE