Protein Info for Dshi_0895 in Dinoroseobacter shibae DFL-12

Annotation: peptidase S1 and S6 chymotrypsin/Hap (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 237 to 257 (21 residues), see Phobius details PF00089: Trypsin" amino acids 386 to 551 (166 residues), 31.2 bits, see alignment E=2e-11 PF13365: Trypsin_2" amino acids 388 to 545 (158 residues), 76.4 bits, see alignment E=4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0895)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRJ0 at UniProt or InterPro

Protein Sequence (621 amino acids)

>Dshi_0895 peptidase S1 and S6 chymotrypsin/Hap (RefSeq) (Dinoroseobacter shibae DFL-12)
MADYFLVKTPLTLENCLSHDGALVLEQHAELRAMLEARAPAAAGLFAEPLISRGNDQAAA
SVSWYGDVDGQPVPLSRLDSASRAEVQARLQAQVTPLLPLLDDPEVGAMLSRALYTLEPG
SIVAVDGTPLLLNWGMLPDGFERDRSARANHFAQTLGAFVPFPAPPPLGPSEAQKYREAI
AAPRAAAGDTGPAPATGAAAAAAATGGMAAASAAKAPPPPPSPPPAEAEPRRVGPGGWVP
LLVLTVLAAVVLLWLLLPGTRLFPNDPSEQAISDVAAAELAEEVNVALEARLASLQAALD
GAQCRADGTLLMPDGMTIEGLLPPDPRDPNDRAGAIVPADLTPILPPDPARVAVPTATGT
LETANLLALVDARTALVIAQTATGTGTGTGFFVGPDLLVTNFHVVEGAAADSIFVTNEAL
GAVRQAQLLKQSGPLQATGADFALLRVPGANQPAFDILQGTESLRLQAVIAAGYPGDILR
TDAQFSQLRAGDLSAVPQLAVTDGTVSVEQDMAPRNTRVVVHSAPISTGNSGGPLLDSCG
RLVGVNTFVVQGPLRNLNFALASPELLGFLQGTGALPNVVSSPCRPQVARPSPPPAVAAL
PAPGAPAEGIPALPLPGATPE