Protein Info for Dshi_0885 in Dinoroseobacter shibae DFL-12

Annotation: oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00005: ABC_tran" amino acids 37 to 185 (149 residues), 116.6 bits, see alignment E=2.1e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 319 (85 residues), 83.2 bits, see alignment E=5.6e-28 PF08352: oligo_HPY" amino acids 236 to 300 (65 residues), 70.9 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_0885)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRI0 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dshi_0885 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSILVSVKGLSRRFDVSKPWLNRVLERLPKAILTAVSDVSFDVEERTVYALVGESGSGKS
TIGKMVVGLLQPSEGSVKIGGTDLARETDPAKLDLVRADIQMIFQDPFASLNPRWRVRDI
INEPVSARGGDVKGLAERLLEQVGLAAEDAGKFPHEFSGGQRQRICIARALASEPKLIVC
DEPTSALDVSVQAQVLNLMSDLKDEFGLTYLFISHDLTVVQHVADRIGVLYLGRLVEEAD
PDTLFENPRHPYTQMLLAAAPKMDGFGREVEPPKGEIPDPINPPTGCAFHPRCPIAVARC
SAERPELRPLGGARVACHLAEA