Protein Info for Dshi_0861 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 225 to 252 (28 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 277 (268 residues), 115.3 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_0861)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRF6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Dshi_0861 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MSAILLIEQVLNGLQFGVMLFLMAAGLTLVFGVMGLINLAHGSLYMVGAFAAAAVAGATG
SFVLGLAAALAAAAAAGALIEVTIIRRLYARDHLDQVLATFALILIFSEGTRWIFGSFPL
FLEVPAALSGPVTLPFGIEYPAYRLAIIGIGLAIAAALFWLIAKTRIGVQIRAGEADREM
IAALGVDIDRLYTLVFALGAALAGLAGALVGALQSVQVGMGEPVLILAFVVIVIGGIGSI
KGAFVGALLLGLTDTLGRTLLPVAFGTVLEPSMATAVGSALASMAIYILMAGVLIFRPSG
LFGQS