Protein Info for Dshi_0859 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00005: ABC_tran" amino acids 23 to 177 (155 residues), 100.7 bits, see alignment E=1.2e-32 PF12399: BCA_ABC_TP_C" amino acids 224 to 248 (25 residues), 38.5 bits, see alignment (E = 6.8e-14)

Best Hits

Swiss-Prot: 34% identical to PHNC1_NOSS1: Phosphonates import ATP-binding protein PhnC 1 (phnC1) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_0859)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRF4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dshi_0859 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MSAPILALDRVTKRFGALEASRAVSLDLRPGEIHALIGPNGAGKSTLIAQITGALRPDAG
TVSLEGRDITGLPTPARARLGLARTFQISQLAMGHTVLENAVLGAQGATGARLSLWRPIL
KDAALRAVAEAALQRVGLAEHAGAVTAELSHGQRRQLEVAVALTLAPRLFVMDEPMAGLG
LEGTAAMTGLLDGLRAEAPILLVEHDMDAVFALADRITVLVAGEVIATGAPEEIRRNRDV
RVAYLGEEGP