Protein Info for Dshi_0789 in Dinoroseobacter shibae DFL-12

Annotation: potassium efflux system protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 420 (408 residues), 166.2 bits, see alignment E=1e-52 PF02254: TrkA_N" amino acids 449 to 563 (115 residues), 87.8 bits, see alignment E=6.9e-29

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 100% identity to dsh:Dshi_0789)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQZ1 at UniProt or InterPro

Protein Sequence (670 amino acids)

>Dshi_0789 potassium efflux system protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTAFLIEATIFLLAAVIAVPLAVRFGLGSVLGYLLAGVIIGPVLGLVGTDVEELQHFAEF
GVVMMLFLIGLELEPRALWDMRDRLLGLGGLQIGLTMAAITGGCILLGFAWPVSLAIGMI
MALSSTAIVLQTLNEKRLMQTPGGRSAFSVLLTQDIAVIPMLAFMPLLALSILPHAPEAQ
SPASGLAGITAAPDGSVQLAPGGTDGHGHDDHSATAVMHLLDQLPGWGLTLVTIAAIAAI
ILGGHYLTRPVFRFIHAARMREMNTAVALLFVTGVASLMLIVDLSPALGTFLAGVVLANS
EYRHELEADIAPFKGLLLGLFFLTVGAGINFGVLFGDPVLLISLTLGLMLIKGVILLGLA
ILFKIRGRDRWLFTLGLAQAGEFGFVLISFAVGTHVLPAELSQTLLLVVALSMLLTPLLF
IVYDQVSARMEEASGPQQPHDEIDEQQPIIIAGIGRFGQVVNRMVQMTGMKTTVLDHDLE
MIELMRRFGFKGFFGDPTRPELLHAAGLDKARVLVVALDDREAGLRLVQYARRMRPDLHI
VARARDRVHVYELYAAGANDIVRETFDSSLRAARYVLENMGMSEFDAADAEHTFFRMDRK
AMRDLAVLWKPGVPVTENTAYVTRAKELNRDLETALVSTLDEGKAVTGYSDRFATLESET
AMKQSRKPTA