Protein Info for Dshi_0736 in Dinoroseobacter shibae DFL-12
Annotation: GCN5-related N-acetyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 37% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)
KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to dsh:Dshi_0736)MetaCyc: 37% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]
Predicted SEED Role
"phosphinothricin N-acetyltransferase"
MetaCyc Pathways
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- superpathway of arginine and polyamine biosynthesis (14/17 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
- L-ornithine biosynthesis I (5/5 steps found)
- phosalacine biosynthesis (4/25 steps found)
- phosphinothricin tripeptide biosynthesis (4/25 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.1
Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LQT8 at UniProt or InterPro
Protein Sequence (161 amino acids)
>Dshi_0736 GCN5-related N-acetyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12) MIRPATQDDAAQIAALWSALIRDTTVTFNSHEKTAADITALLADKAAADQPFLVALHAGR VAGFATYGPFRNGPGYARTIEHSILLDTAARGQGLGRGLMSALEDHARTRGMHTLWAGVS GENPAGVTFHRHLGFAEVATLREVGYKFGRWIDLVLMCKRL