Protein Info for Dshi_0736 in Dinoroseobacter shibae DFL-12

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF13302: Acetyltransf_3" amino acids 2 to 135 (134 residues), 42 bits, see alignment E=3.7e-14 PF13420: Acetyltransf_4" amino acids 2 to 155 (154 residues), 65.5 bits, see alignment E=1.5e-21 PF00583: Acetyltransf_1" amino acids 24 to 135 (112 residues), 62 bits, see alignment E=1.7e-20 PF13673: Acetyltransf_10" amino acids 47 to 143 (97 residues), 28.9 bits, see alignment E=2.6e-10 PF13508: Acetyltransf_7" amino acids 50 to 136 (87 residues), 39.6 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 37% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to dsh:Dshi_0736)

MetaCyc: 37% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"phosphinothricin N-acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQT8 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Dshi_0736 GCN5-related N-acetyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MIRPATQDDAAQIAALWSALIRDTTVTFNSHEKTAADITALLADKAAADQPFLVALHAGR
VAGFATYGPFRNGPGYARTIEHSILLDTAARGQGLGRGLMSALEDHARTRGMHTLWAGVS
GENPAGVTFHRHLGFAEVATLREVGYKFGRWIDLVLMCKRL