Protein Info for Dshi_0734 in Dinoroseobacter shibae DFL-12

Annotation: monovalent cation/proton antiporter, MnhG/PhaG subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 11 to 96 (86 residues), 87.2 bits, see alignment E=3.7e-29 PF03334: PhaG_MnhG_YufB" amino acids 11 to 88 (78 residues), 89.3 bits, see alignment E=7.8e-30

Best Hits

Swiss-Prot: 32% identical to MNHG1_STAS1: Na(+)/H(+) antiporter subunit G1 (mnhG1) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 100% identity to dsh:Dshi_0734)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQT6 at UniProt or InterPro

Protein Sequence (115 amino acids)

>Dshi_0734 monovalent cation/proton antiporter, MnhG/PhaG subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTVLEWIVAALLVGGGFFSLIAALGVVRMQDVYIRMHASTKAGTLGVGMIAGAVALLTSG
ESVAKEIVIILFLLFTAPIGAHVIARAAFQSRVPLWGEKPEDINRDNFKCENGQD