Protein Info for Dshi_0733 in Dinoroseobacter shibae DFL-12

Annotation: multiple resistance and pH regulation protein F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details PF04066: MrpF_PhaF" amino acids 47 to 98 (52 residues), 64.7 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 40% identical to PHF2_RHIME: PhaF2 protein (phaF2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05570, multicomponent Na+:H+ antiporter subunit F (inferred from 100% identity to dsh:Dshi_0733)

Predicted SEED Role

"Na(+) H(+) antiporter subunit F" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQT5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Dshi_0733 multiple resistance and pH regulation protein F (RefSeq) (Dinoroseobacter shibae DFL-12)
MLEFFSSLLIETRQTGPLGVAVLLSFVMVVAALVLSTIRLLRGPTLPDRVVALDLISILL
VALLTLFAISSQVDAYLDAAIVLALVAFLGTVALARFVLRSGRNYKSGTPMPPGEERP