Protein Info for Dshi_0731 in Dinoroseobacter shibae DFL-12

Annotation: NADH dehydrogenase (quinone) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details amino acids 402 to 427 (26 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 125 to 414 (290 residues), 197.1 bits, see alignment E=2e-62

Best Hits

Swiss-Prot: 46% identical to MRPD_BACPE: Na(+)/H(+) antiporter subunit D (mrpD) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 100% identity to dsh:Dshi_0731)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQT3 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Dshi_0731 NADH dehydrogenase (quinone) (RefSeq) (Dinoroseobacter shibae DFL-12)
MILVWPIVIPMITAVITLLLRKTALAYHVSLLGSVALLGSGLILLRAVLTGGPMAAQMGG
WEAPFGITLFADILSAAMVVIAGIVAVAVIVYSRFDVTEDEKRVGFHALSHALLVGVCGA
FLTGDIFNLYVWFEVMLIASFGLLVIGGRRDQIDAAVKYVGLNLVATLAFLTGVGILYGA
AGTLNMADLHLVLADRQSETAVLASAALLLFAFGAKAAMFPVFAWLPASYHTPAFATSAL
FAALLTKVGVYALLRVFTVVYDGGGGFIQPILLIGAVLTMVIGVLGAAAQNDVRRILSFH
IISQIGYMVLGLALFTPLAIIGAIFYLFHHIIVKANLFFVAGLIKLKAGSEELDKIGGLL
KASPFLAILFLIPALSLAGIPPLSGFWAKFIIVQASLEARDWWVALAALAVGLITLFSMT
KIWLAAFWKDHPDAAFAKGPVMPRSMTAPIAVLAVMTVIIGLGAGPLYTVAEEAAITLLD
PLAYVEVVLGPEVAETARAERAATQLAEVSQ