Protein Info for Dshi_0730 in Dinoroseobacter shibae DFL-12

Annotation: NADH-ubiquinone oxidoreductase chain 4L (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details PF00420: Oxidored_q2" amino acids 5 to 111 (107 residues), 69 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K05567, multicomponent Na+:H+ antiporter subunit C (inferred from 100% identity to dsh:Dshi_0730)

Predicted SEED Role

"Na(+) H(+) antiporter subunit C" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQT2 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Dshi_0730 NADH-ubiquinone oxidoreductase chain 4L (RefSeq) (Dinoroseobacter shibae DFL-12)
MELVIAALVGFLVAGGAYLMMSGQLIRFLFGLVLLSNAANLGIFASGRLTYATPPFVPEG
STATAVTAANALPQALILTAIVIGFGLLAFALALAFRAWQSLGTVEMDAMRACEPLEPPT
PPVASTPTPVTGSRREAAE