Protein Info for Dshi_0689 in Dinoroseobacter shibae DFL-12

Annotation: isocitrate lyase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF13714: PEP_mutase" amino acids 15 to 246 (232 residues), 147.6 bits, see alignment E=4.7e-47 PF00463: ICL" amino acids 77 to 165 (89 residues), 52 bits, see alignment E=4.3e-18

Best Hits

Swiss-Prot: 48% identical to PRPB_AERPE: 2-methylisocitrate lyase (prpB) from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0689)

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQE9 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Dshi_0689 isocitrate lyase family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSGPATPCWDFTRPGIVMAPGVYDALTASLAEAAGFPALYLSGAAVSYTRLGRPDIGLTS
VTEMTETLSLIRDRVSTPIIIDADTGFGNALNAQRTMRLYERAGANALQIEDQAYPKRCG
HLADKTLIPAQEMAGKIRAMADARHAAQTLIIARTDAVAVEGFEAAQERAETYLEAGADI
LFIEAPQSEAQLTAIAQRFRGRVPLLANMVEGGETPMKSARELEALGYALVIFPGGIVRA
LARTAEAYYLSLSETGSNAAFRDRMFDFQDLNARLGTAEMLARGKAYEGPGT