Protein Info for Dshi_0686 in Dinoroseobacter shibae DFL-12

Annotation: regulatory protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 410 to 430 (21 residues), see Phobius details amino acids 442 to 466 (25 residues), see Phobius details amino acids 485 to 506 (22 residues), see Phobius details amino acids 545 to 564 (20 residues), see Phobius details amino acids 584 to 605 (22 residues), see Phobius details PF12801: Fer4_5" amino acids 484 to 530 (47 residues), 52.5 bits, see alignment 2e-18 amino acids 591 to 625 (35 residues), 17 bits, see alignment (E = 2.3e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0686)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQE6 at UniProt or InterPro

Protein Sequence (696 amino acids)

>Dshi_0686 regulatory protein, putative (RefSeq) (Dinoroseobacter shibae DFL-12)
MMSVLMRLALVALLFLPLAGRAEPLSREEMAAQILPPFTLGEPLGENGVWSLLNAGGTQA
GYVFETEPMAPLPGFSGAPINLLVLLDLEGRFEHVVLLEHNEPIFVSGLGEAPFHAFFEQ
YRGRSISDSLVVGTPYGGGDAGGGLIYLDGVTKATASVRIAHESILAATLQVARQKMQGV
ATGPPAYPDPNNAEILSFQDLIDQGLLTRTVVSNAEVQAQFADTIWEDDDPAALDEPEAP
YLDLWIADLGPPAVARALLSEDGYAELQDFLEISGSDEPILMIETGRHGLVSEDFVRNTA
PAWLSVTQDGLPVALRDSDILVELHPDLPDALQDGVAMILRTDRRLGFDPTREWTLGVEA
VRSHGMLQPEIGSVTLTTTYASDPRFFLRPEITGPLPPWQEALLNRQTDLIVLAVFLAGL
LALLAARMNWLAGLAQFTPVRLGILAFVTVFIGWWGQGQLSIVTVLGVLRTTLEGASFAF
LLYDPFSLVIWGVTILGFVLWGRGLFCGWLCPFGALQEFAHHVGRKLRLPRIEPTEAWDR
RLKGLKYVVLAGLIATVLIAPQHVDTVAEVEPFKTAITVFFVREWYYVAYAVLWLGLALV
LFKGFCRYVCPLGAVMALGGLVRGRDWIARRAECGSPCQLCRVKCEYGAIQPTGEIAYSE
CFQCLDCVTIHDSKQMCVPLILEARKDQRVKGVAAK